Products

CXCL1 (C-X-C motif chemokine 1), Mouse

CXCL1/GROa act as a growth factor for melanoma cells. It is also a chemotaxin for neutrophils. Like other alpha chemokines, this protein is potent neutrophil attractant and activator and is also affect basophils. Clinical research show that CXCL1 protein may be a therapeutic target as well as a diagnostic marker in ovarian cancer.
No. Size Price Qty Status
C02073-5UG 5 ug $108.00 Inquiry
C02073-20UG 20 ug $268.00 Inquiry
C02073-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

UnitProt ID:
P12850
 
Source:
Escherichia coli
 
Endotoxin Test:

<0.1 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <15 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for CXCL1 (C-X-C motif chemokine 1), Mouse

Average Rating: 0 (0 Reviews )